PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G0478
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 281aa    MW: 32165 Da    PI: 6.3926
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G0478genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.9e-192370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll ++v+++G g+W++ a++ g++Rt+k+c++rw++yl
      Gh_A09G0478 23 RGPWTLEEDSLLTHYVARHGEGHWNLLAKHAGLRRTGKSCRLRWLNYL 70
                     89********************************************97 PP

2Myb_DNA-binding48.71.7e-1576119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE+ l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_A09G0478  76 RGNLTPEEQFLILELHCKWGNR-WSKIAQELP-GRTDNEIKNYWRT 119
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.551874IPR017930Myb domain
SuperFamilySSF466891.26E-3021117IPR009057Homeodomain-like
SMARTSM007179.5E-162272IPR001005SANT/Myb domain
PfamPF002492.5E-172370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-232477IPR009057Homeodomain-like
CDDcd001671.88E-112570No hitNo description
PROSITE patternPS0017503847IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
SMARTSM007173.9E-1375123IPR001005SANT/Myb domain
PROSITE profilePS5129418.99875125IPR017930Myb domain
PfamPF002492.7E-1476119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2378124IPR009057Homeodomain-like
CDDcd001673.71E-1080119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MSSFTKVSSS TSCSEEDTEQ LRRGPWTLEE DSLLTHYVAR HGEGHWNLLA KHAGLRRTGK  60
SCRLRWLNYL KPDVKRGNLT PEEQFLILEL HCKWGNRWSK IAQELPGRTD NEIKNYWRTR  120
VQKQARHLKI DANSAAFRNV IRCFWMPRLL QMMKGSSTLP QQVAGLEQQN SDSEQCASSC  180
VSSSESMNNN MSKISEFAEY QTSSFGITDN NEYNTVAKDC YYVDNSSCYG METINLPSTS  240
AVGDFMTADC HMADNNWVND GFADGIWSMG ELWELPLKWN L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27211255108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.66931e-132leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO310733761e-132
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012484284.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE13e-62MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2SSQ00.0A0A0D2SSQ0_G
STRINGPOPTR_0015s03770.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.19e-76myb domain protein 116